Các bài viết có thể truy cập công khai - Alpa PatelTìm hiểu thêm
Tổng thểNIHCancer Research UKSwedish Research CouncilMRCNHMRCEuropean CommissionGovernment of SpainINSERMNIHRCIHRDoDWellcomeState of CalifoniaBMBFSusan G. KomenBHFBreast Cancer Now, UKGenome CanadaAIRC Foundation for Cancer Research in ItalyGovernment of ItalyHelmholtzWorld Cancer Researh Fund, UKCCSKWFANREPSRCSCLVANSERCDFGDFFRCNNordforskSNSFHHMIFWOAcademy of FinlandFORTEA*StarRWJFHRBBlood Cancer UKYorkshire Cancer Research, UKMSFHRNMRCJDRFNational Research Foundation, SingaporeCPRITNSFDOEDoTAHANSFCSFIWellcome Trust/DBT India AllianceDiabetes UKStroke Association, UKPCORIBusiness FinlandUK Research & InnovationAutism Speaks Inc, USAPancreatic Cancer Action Network, USAV Foundation, USAOICRCanada First Research Excellence Fund
Không có ở bất kỳ nơi nào: 17
Pancreatic cancer risk and ABO blood group alleles: results from the pancreatic cancer cohort consortium
BM Wolpin, P Kraft, M Gross, K Helzlsouer, HB Bueno-de-Mesquita, ...
Cancer research 70 (3), 1015-1023, 2010
Các cơ quan ủy nhiệm: US National Institutes of Health, National Institute of Health and Medical …
Waist circumference, body mass index, and postmenopausal breast cancer incidence in the Cancer Prevention Study-II Nutrition Cohort
MM Gaudet, BD Carter, AV Patel, LR Teras, EJ Jacobs, SM Gapstur
Cancer Causes & Control 25, 737-745, 2014
Các cơ quan ủy nhiệm: US National Institutes of Health
Body mass index, height and risk of lymphoid neoplasms in a large United States cohort
AV Patel, WR Diver, LR Teras, BM Birmann, SM Gapstur
Leukemia & lymphoma 54 (6), 1221-1227, 2013
Các cơ quan ủy nhiệm: US National Institutes of Health
Body weight in early adulthood, adult weight gain, and risk of endometrial cancer in women not using postmenopausal hormones
VL Stevens, EJ Jacobs, AV Patel, J Sun, SM Gapstur, ML McCullough
Cancer Causes & Control 25, 321-328, 2014
Các cơ quan ủy nhiệm: US National Institutes of Health
Moderate-to-vigorous physical activity and leisure-time sitting in relation to ovarian cancer risk in a large prospective US cohort
JS Hildebrand, SM Gapstur, MM Gaudet, PT Campbell, AV Patel
Cancer Causes & Control 26, 1691-1697, 2015
Các cơ quan ủy nhiệm: US National Institutes of Health
Postmenopausal unopposed estrogen and estrogen plus progestin use and risk of non-Hodgkin lymphoma in the American Cancer Society Cancer Prevention Study-II Cohort
LR Teras, AV Patel, JS Hildebrand, SM Gapstur
Leukemia & Lymphoma 54 (4), 720-725, 2013
Các cơ quan ủy nhiệm: US National Institutes of Health
Recreational physical activity, leisure sitting time and risk of Non‐Hodgkin lymphoid neoplasms in the American Cancer Society Cancer Prevention Study II cohort
LR Teras, SM Gapstur, WR Diver, BM Birmann, AV Patel
International journal of cancer 131 (8), 1912-1920, 2012
Các cơ quan ủy nhiệm: US National Institutes of Health
Association of glycaemic index and glycaemic load with type 2 diabetes, cardiovascular disease, cancer, and all-cause mortality: a meta-analysis of mega cohorts of more than …
DJA Jenkins, WC Willett, S Yusuf, FB Hu, AJ Glenn, S Liu, A Mente, ...
The Lancet Diabetes & Endocrinology 12 (2), 107-118, 2024
Các cơ quan ủy nhiệm: Canadian Institutes of Health Research, State of Califonia
Fused imidazoles as potential chemical scaffolds for inhibition of heat shock protein 70 and induction of apoptosis. Synthesis and biological evaluation of phenanthro [9, 10-d …
A Patel, SY Sharp, K Hall, W Lewis, MFG Stevens, P Workman, CJ Moody
Organic & biomolecular chemistry 14 (16), 3889-3905, 2016
Các cơ quan ủy nhiệm: Cancer Research UK, UK Engineering and Physical Sciences Research Council
Joint associations of physical activity and body mass index with the risk of established excess body fatness-related cancers among postmenopausal women
ML Maliniak, SM Gapstur, LE McCullough, E Rees-Punia, MM Gaudet, ...
Cancer Causes & Control 32, 127-138, 2021
Các cơ quan ủy nhiệm: US National Institutes of Health
Breast cancer risk factors by mode of detection among screened women in the Cancer Prevention Study-II
MM Gaudet, E Deubler, WR Diver, S Puvanesarajah, AV Patel, T Gansler, ...
Breast Cancer Research and Treatment 186, 791-805, 2021
Các cơ quan ủy nhiệm: US National Institutes of Health
Epidemiologic risk factors for in situ and invasive ductal breast cancer among regularly screened postmenopausal women by grade in the Cancer Prevention Study-II Nutrition Cohort
S Puvanesarajah, SM Gapstur, T Gansler, ME Sherman, AV Patel, ...
Cancer Causes & Control 31, 95-103, 2020
Các cơ quan ủy nhiệm: US National Institutes of Health
Anthropometric factors and risk of myeloid leukaemias and myelodysplastic syndromes: a prospective study and meta‐analysis
LR Teras, AV Patel, BD Carter, E Rees‐Punia, ML McCullough, ...
British Journal of Haematology 186 (2), 243-254, 2019
Các cơ quan ủy nhiệm: US National Institutes of Health
Physical activity, sitting time, and risk of myelodysplastic syndromes, acute myeloid leukemia, and other myeloid malignancies
E Rees-Punia, AV Patel, EA Fallon, SM Gapstur, LR Teras
Cancer Epidemiology, Biomarkers & Prevention 28 (9), 1489-1494, 2019
Các cơ quan ủy nhiệm: US National Institutes of Health
Educational attainment and cancer incidence in a large nationwide prospective cohort
JM Hodge, AV Patel, F Islami, A Jemal, RA Hiatt
Cancer Epidemiology, Biomarkers & Prevention 32 (12), 1747-1755, 2023
Các cơ quan ủy nhiệm: US National Institutes of Health
Physical activity, obesity, and bladder cancer incidence
S Chantaprasopsuk, E Rees-Punia, AV Patel
Cancer Causes & Control 34 (8), 715-724, 2023
Các cơ quan ủy nhiệm: US National Institutes of Health
Genome-wide analysis to assess if heavy alcohol consumption modifies the association between SNPs and pancreatic cancer risk
Z Ni, P Kundu, DF McKean, W Wheeler, D Albanes, G Andreotti, SO Antwi, ...
Cancer Epidemiology, Biomarkers & Prevention 33 (9), 1229-1239, 2024
Các cơ quan ủy nhiệm: National Health and Medical Research Council, Australia, Cancer Research UK …
Có tại một số nơi: 144
Body-mass index and all-cause mortality: individual-participant-data meta-analysis of 239 prospective studies in four continents
E Di Angelantonio, SN Bhupathiraju, D Wormser, P Gao, S Kaptoge, ...
The lancet 388 (10046), 776-786, 2016
Các cơ quan ủy nhiệm: US National Institutes of Health, British Heart Foundation, Cancer Research …
Risk of COVID-19 among front-line health-care workers and the general community: a prospective cohort study
LH Nguyen, DA Drew, MS Graham, AD Joshi, CG Guo, W Ma, RS Mehta, ...
The Lancet Public Health 5 (9), e475-e483, 2020
Các cơ quan ủy nhiệm: US National Institutes of Health, British Heart Foundation, UK Engineering …
Exercise guidelines for cancer survivors: consensus statement from international multidisciplinary roundtable
KL Campbell, K Winters-Stone, J Wiskemann, AM May, AL Schwartz, ...
Medicine and science in sports and exercise 51 (11), 2375, 2019
Các cơ quan ủy nhiệm: US National Institutes of Health
Chương trình máy tính sẽ tự động xác định thông tin xuất bản và thông tin về nhà tài trợ