Artykuły udostępnione publicznie: - Xing-Huang GaoWięcej informacji
OgółemNIHAHAWellcomeSNSFUSEDVAHHMIFWFCCSCIHRFRQSNSERCCSIRDBTDSTTelethonKnut and Alice Wallenberg FoundationSwedish Research CouncilVersus Arthritis, UKBBSRCBHFCancer Research UKMRCNational Centre for the Replacement, Refinement and Reduction of Animals in Research, UKParkinson's UKWorldwide Cancer Research, UKDoris Duke Charitable FoundationANR
Dostępne w jakimś miejscu: 14
Guidelines for the use and interpretation of assays for monitoring autophagy (4th edition)1
DJ Klionsky, AK Abdel-Aziz, S Abdelfatah, M Abdellatif, A Abdoli, S Abel, ...
autophagy 17 (1), 1-382, 2021
Upoważnienia: Swiss National Science Foundation, US National Institutes of Health, US …
Angiogenin-cleaved tRNA halves interact with cytochrome c, protecting cells from apoptosis during osmotic stress
M Saikia, R Jobava, M Parisien, A Putnam, D Krokowski, XH Gao, ...
Molecular and cellular biology, 2014
Upoważnienia: US National Institutes of Health, Council of Scientific and Industrial …
DNMT1-associated long non-coding RNAs regulate global gene expression and DNA methylation in colon cancer
CR Merry, ME Forrest, JN Sabers, L Beard, XH Gao, M Hatzoglou, ...
Human molecular genetics 24 (21), 6240-6253, 2015
Upoważnienia: US National Institutes of Health
Quantitative H2S-mediated protein sulfhydration reveals metabolic reprogramming during the integrated stress response
XH Gao, D Krokowski, BJ Guan, I Bederman, M Majumder, M Parisien, ...
elife 4, e10067, 2015
Upoważnienia: US National Institutes of Health, Natural Sciences and Engineering Research …
A unique ISR program determines cellular responses to chronic stress
BJ Guan, V van Hoef, R Jobava, O Elroy-Stein, LS Valasek, M Cargnello, ...
Molecular cell 68 (5), 885-900. e6, 2017
Upoważnienia: US National Institutes of Health, Canadian Cancer Society, Canadian …
Mechanisms of altered redox regulation in neurodegenerative diseases—focus on S-glutathionylation
EA Sabens Liedhegner, XH Gao, JJ Mieyal
Antioxidants & redox signaling 16 (6), 543-566, 2012
Upoważnienia: US National Institutes of Health
GADD34 function in protein trafficking promotes adaptation to hyperosmotic stress in human corneal cells
D Krokowski, BJ Guan, J Wu, Y Zheng, PP Pattabiraman, R Jobava, ...
Cell reports 21 (10), 2895-2910, 2017
Upoważnienia: US National Institutes of Health
Discovery of a redox thiol switch: implications for cellular energy metabolism
XH Gao, L Li, M Parisien, J Wu, I Bederman, Z Gao, D Krokowski, ...
Molecular & Cellular Proteomics 19 (5), 852-870, 2020
Upoważnienia: US National Institutes of Health
Adverse outcomes associated with cigarette smoke radicals related to damage to protein-disulfide isomerase
H Kenche, ZW Ye, K Vedagiri, DM Richards, XH Gao, KD Tew, ...
Journal of Biological Chemistry 291 (9), 4763-4778, 2016
Upoważnienia: US National Institutes of Health
Hydrogen sulfide modulates eukaryotic translation initiation factor 2α (eIF2α) phosphorylation status in the integrated stress-response pathway
V Yadav, XH Gao, B Willard, M Hatzoglou, R Banerjee, O Kabil
Journal of Biological Chemistry 292 (32), 13143-13153, 2017
Upoważnienia: US National Institutes of Health, American Heart Association
PACT-mediated PKR activation acts as a hyperosmotic stress intensity sensor weakening osmoadaptation and enhancing inflammation
KT Farabaugh, D Krokowski, BJ Guan, Z Gao, XH Gao, J Wu, R Jobava, ...
Elife 9, e52241, 2020
Upoważnienia: US National Institutes of Health
Aging-dependent changes in rat heart mitochondrial glutaredoxins—implications for redox regulation
XH Gao, S Qanungo, HV Pai, DW Starke, KM Steller, H Fujioka, ...
Redox Biology 1 (1), 586-598, 2013
Upoważnienia: US National Institutes of Health
Protein kinase R mediates the inflammatory response induced by hyperosmotic stress
KT Farabaugh, M Majumder, BJ Guan, R Jobava, J Wu, D Krokowski, ...
Molecular and Cellular Biology 37 (4), e00521-16, 2017
Upoważnienia: US National Institutes of Health
Atypical Iron-Sulfur Cluster Binding, Redox Activity and Structural Properties of Chlamydomonas reinhardtii Glutaredoxin 2
T Roret, B Zhang, A Moseler, T Dhalleine, XH Gao, J Couturier, ...
Antioxidants 10 (5), 803, 2021
Upoważnienia: US National Institutes of Health, Agence Nationale de la Recherche
Informacje na temat publikacji i finansowania automatycznie określa program komputerowy