مقالههای دارای تعهدات انتشار عمومی - remuzzi g*بیشتر بدانید
درمجموعNIHGatesGovernment of ItalyEuropean CommissionMRCNHMRCNIHRWellcomeGovernment of SpainFCTBHFBMBFTelethonNSFCDFGFondazione CariploCIHRSwedish Research CouncilMESTDSNSFUSAIDWellcome Trust/DBT India AllianceEDCTPNWONRFAcademy of FinlandCancer Research UKESRCHealth Data Research, UKDoDAHASFIDSTFRQSDNRFINSERMDFIDEPSRCNKFIUK Research & InnovationNSFHHMIARCFWODBTA*StarRCNNASAVANOAAFWFNSERCCASKnut and Alice Wallenberg FoundationMarianne and Marcus Wallenberg FoundationAcademy of Medical Sciences, UKVersus Arthritis, UKBBSRCCSOWHOZonMwDoris Duke Charitable FoundationDHFNMRCResearch Grants Council, Hong KongTUBITAKCGIARAIRC Foundation for Cancer Research in ItalyJDRFDamon Runyon Cancer Research FoundationAXA Research Fund, France
جای دیگری دردسترس نیست: ۱۸
Eculizumab in a patient with dense-deposit disease
E Daina, M Noris, G Remuzzi
New England Journal of Medicine 366 (12), 1161-1163, 2012
تعهدات: Fondazione Telethon, Italy
Complement gene variants determine the risk of immunoglobulin-associated MPGN and C3 glomerulopathy and predict long-term renal outcome
P Iatropoulos, M Noris, C Mele, R Piras, E Valoti, E Bresin, M Curreri, ...
Molecular immunology 71, 131-142, 2016
تعهدات: Fondazione Telethon, Italy
Effects of blood pressure lowering on cardiovascular risk according to baseline body-mass index: a meta-analysis of randomised trials
BPLT Trialists’Collaboration, A Ying, H Arima, S Czernichow, ...
Lancet 385 (9971), 867-74, 2015
تعهدات: Australian Research Council, National Health and Medical Research Council …
C5 convertase blockade in membranoproliferative glomerulonephritis: a single-arm clinical trial
P Ruggenenti, E Daina, A Gennarini, C Carrara, S Gamba, M Noris, ...
American Journal of Kidney Diseases 74 (2), 224-238, 2019
تعهدات: Government of Italy
Interaction between multimeric von Willebrand factor and complement: a fresh look to the pathophysiology of microvascular thrombosis
S Bettoni, M Galbusera, S Gastoldi, R Donadelli, C Tentori, G Spartà, ...
The Journal of Immunology 199 (3), 1021-1040, 2017
تعهدات: US National Institutes of Health
Trends in cardiovascular diseases burden and vascular risk factors in Italy: The Global Burden of Disease study 1990–2017
PA Cortesi, C Fornari, F Madotto, S Conti, M Naghavi, B Bikbov, PS Briant, ...
European journal of preventive cardiology 28 (4), 385-396, 2021
تعهدات: Bill & Melinda Gates Foundation, Government of Italy
Autoimmune abnormalities of the alternative complement pathway in membranoproliferative glomerulonephritis and C3 glomerulopathy
M Noris, R Donadelli, G Remuzzi
Pediatric Nephrology 34 (8), 1311-1323, 2019
تعهدات: Government of Italy
Podocyte dysfunction in atypical haemolytic uraemic syndrome
M Noris, C Mele, G Remuzzi
Nature Reviews Nephrology 11 (4), 245-252, 2015
تعهدات: Fondazione Telethon, Italy
Genetics and genetic testing in hemolytic uremic syndrome/thrombotic thrombocytopenic purpura
M Noris, G Remuzzi
Seminars in nephrology 30 (4), 395-408, 2010
تعهدات: Fondazione Telethon, Italy
Lack of the lectin-like domain of thrombomodulin worsens Shiga toxin-associated hemolytic uremic syndrome in mice
C Zoja, M Locatelli, C Pagani, D Corna, C Zanchi, B Isermann, G Remuzzi, ...
The Journal of Immunology 189 (7), 3661-3668, 2012
تعهدات: Canadian Institutes of Health Research
Genetics of immune-mediated glomerular diseases: focus on complement
M Noris, G Remuzzi
Seminars in nephrology 37 (5), 447-463, 2017
تعهدات: European Commission
Membranoproliferative glomerulonephritis: no longer the same disease and may need very different treatment
M Noris, E Daina, G Remuzzi
Nephrology Dialysis Transplantation 38 (2), 283-290, 2023
تعهدات: Government of Italy
Two years of SARS-CoV-2 pandemic and COVID-19 in Lombardy, Italy
PM Mannucci, AA Galbussera, B D’Avanzo, M Tettamanti, G Remuzzi, ...
Internal and Emergency Medicine 18 (5), 1445-1451, 2023
تعهدات: Government of Italy
New biologics in the treatment of rare glomerular diseases of childhood
P Cravedi, A Angeletti, G Remuzzi
Current Opinion in Pharmacology 33, 27-33, 2017
تعهدات: US National Institutes of Health
Therapeutic small interfering RNA targeting complement C3 in a mouse model of C3 glomerulopathy
C Zanchi, M Locatelli, D Cerullo, V Aumiller, D Corna, D Rottoli, ...
The Journal of Immunology 208 (7), 1772-1781, 2022
تعهدات: Government of Italy
CRISPR-Cas9-mediated correction of the G189R-PAX2 mutation in induced pluripotent stem cells from a patient with focal segmental glomerulosclerosis
P Trionfini, O Ciampi, M Todeschini, C Ascanelli, L Longaretti, L Perico, ...
The CRISPR Journal 2 (2), 108-120, 2019
تعهدات: Fondazione Telethon, Italy
AAV9-mediated engineering of autotransplanted kidney of non-human primates
S Tomasoni, P Trionfini, N Azzollini, L Zentilin, M Giacca, S Aiello, ...
Gene Therapy 24 (5), 308-313, 2017
تعهدات: Fondazione Cariplo
Developmental Approaches to Kidney Regeneration
V Benedetti, B Imberti, C Xinaris, G Remuzzi
Kidney Transplantation, Bioengineering and Regeneration, 1039-1050, 2017
تعهدات: Government of Italy
جای دیگری دردسترس است: ۲۵۶
Heart disease and stroke statistics—2017 update: a report from the American Heart Association
EJ Benjamin, MJ Blaha, SE Chiuve, M Cushman, SR Das, R Deo, ...
circulation 135 (10), e146-e603, 2017
تعهدات: US National Institutes of Health, American Heart Association
Global, regional, and national incidence, prevalence, and years lived with disability for 301 acute and chronic diseases and injuries in 188 countries, 1990–2013: a systematic …
T Vos, RM Barber, B Bell, A Bertozzi-Villa, S Biryukov, I Bolliger, ...
The lancet 386 (9995), 743-800, 2015
تعهدات: Swiss National Science Foundation, Bill & Melinda Gates Foundation, US …
اطلاعات انتشارات و تأمین بودجه بهطورخودکار توسط برنامه رایانهای تعیین میشود.